PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27001.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 335aa    MW: 37648 Da    PI: 6.6456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27001.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.6e-152976148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
  mrna27001.1-v1.0-hybrid 29 KGLWSPEEDEKLMRYMLSNGQGCWSDIARNSGLQRCGKSCRLRWINYL 76
                             678*******************************************97 PP

2Myb_DNA-binding47.54.2e-1582125146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E+ l+++ +  lG++ W+ Ia++++ gRt++++k++w++
  mrna27001.1-v1.0-hybrid  82 RGAFSPQEEHLIIHFHSILGNK-WSQIAARLP-GRTDNEIKNFWNS 125
                              89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-232279IPR009057Homeodomain-like
PROSITE profilePS5129417.662476IPR017930Myb domain
SuperFamilySSF466897.03E-2827123IPR009057Homeodomain-like
SMARTSM007174.9E-112878IPR001005SANT/Myb domain
PfamPF002493.8E-132976IPR001005SANT/Myb domain
CDDcd001672.80E-93276No hitNo description
PROSITE profilePS5129424.41277131IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2580132IPR009057Homeodomain-like
SMARTSM007174.1E-1381129IPR001005SANT/Myb domain
PfamPF002492.8E-1482125IPR001005SANT/Myb domain
CDDcd001676.27E-984124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MRKPELSIEK DVKANNNSKN KMMHNKLRKG LWSPEEDEKL MRYMLSNGQG CWSDIARNSG  60
LQRCGKSCRL RWINYLRPDL KRGAFSPQEE HLIIHFHSIL GNKWSQIAAR LPGRTDNEIK  120
NFWNSALKKR LKNNISTSTS SPDESDHSSE PNVNIGGAIR PFIPAMHNEQ DMLMSMMYID  180
SSTSSSSASM HVINNSTFEP SFSVLDSSSL LNYVDHTGST QLPEGQYGDY GNYLEAGHKM  240
GIEGDHLCLP PLETSRRNLT ENKNGQVVDK ISNNNINHFH NNNSNNCFIN TASNMSFKLD  300
DGDIFGQAEA GGSLRVGEEW DFEGFMQDIS CFLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262113119128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9703571e-60AY970357.1 Prunus salicina clone PSX08 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308219.10.0PREDICTED: transcription factor MYB46
TrEMBLM5XMW61e-116M5XMW6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s06630.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.16e-69myb domain protein 46